PDB entry 2bam

View 2bam on RCSB PDB site
Description: restriction endonuclease bamhi complex with DNA and calcium ions (pre-reactive complex).
Class: hydrolase/DNA
Keywords: phosphodiesterase, complex (endonuclease-DNA), nuclease, hydrolase-DNA complex
Deposited on 1998-08-19, released 1999-01-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-07-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.233
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (endonuclease bamhi)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bama_
  • Chain 'B':
    Compound: protein (endonuclease bamhi)
    Species: Bacillus amyloliquefaciens [TaxId:1390]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2bamb_
  • Chain 'C':
    Compound: DNA (5'-d(*tp*ap*tp*gp*gp*ap*tp*cp*cp*ap*tp*a)-3')
  • Chain 'D':
    Compound: DNA (5'-d(*tp*ap*tp*gp*gp*ap*tp*cp*cp*ap*tp*a)-3')
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bamA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bamA (A:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2bamB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkvenk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bamB (B:)
    mevekefitdeakellskdkliqqaynevktsicspiwpatsktftinntekncngvvpi
    kelcytlledtynwyrekpldilklekkkggpidvykefienselkrvgmefetgnissa
    hrsmnklllglkhgeidlaiilmpikqlayyltdrvtnfeelepyfeltegqpfifigfn
    aeaynsnvplipkgsdgmskrsikkwkdkv
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.