PDB entry 2bak

View 2bak on RCSB PDB site
Description: p38alpha MAP kinase bound to MPAQ
Class: transferase
Keywords: p38 MAP Kinase, serine/threonine kinase, TRANSFERASE
Deposited on 2005-10-14, released 2005-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.22
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2baka_
  • Heterogens: AQZ, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bakA (A:)
    hhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq
    eemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bakA (A:)
    rptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqsiih
    akrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkltddhv
    qfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfgvatrwyrapeimlnwmh
    ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi
    qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv
    adpydqsfesrdllidewksltydevisfvpppl