PDB entry 2baj

View 2baj on RCSB PDB site
Description: p38alpha bound to pyrazolourea
Class: transferase
Keywords: Mitogen Activated Protein Kinase, TRANSFERASE
Deposited on 2005-10-14, released 2005-12-06
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-12-05, with a file datestamp of 2012-11-30.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, MXI2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16539 (6-End)
      • expression tag (3-5)
    Domains in SCOPe 2.06: d2baja2, d2baja3
  • Heterogens: 1PP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2bajA (A:)
    hhhhhhsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkkl
    srpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlnn
    ivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarht
    ddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkli
    lrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsdk
    ritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppldq
    eemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >2bajA (A:)
    hhhsqerptfyrqeliwevperyqnlspvgsgaygsvcaafdtktglrvavkklsrpfqs
    iihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadlndhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfglarhtddemtgyvatrwyrap
    eimlnnqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesr
    nyiqsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpdd
    epvadpydqsfesrdllidewksltydevisfvpppl