PDB entry 2bai

View 2bai on RCSB PDB site
Description: The Zinc finger domain of Mengovirus Leader polypeptide
Class: viral protein
Keywords: Zinc finger domain, NMR, virus, viruses, cardiovirus, mengovirus, Structural Genomics, PSI, Protein Structure Initiative, Center for Eukaryotic Structural Genomics, CESG, VIRAL PROTEIN
Deposited on 2005-10-14, released 2006-01-24
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.01 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Genome polyprotein
  Species: Mengo virus [TaxId:12107]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P32540 (0-31)
  Domains in SCOPe 2.08: d2baia1
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2baiA (A:)
  mattmeqeicahsmtfeecpkcsalqyrngfy