PDB entry 2baa

View 2baa on RCSB PDB site
Description: the refined crystal structure of an endochitinase from hordeum vulgare l. seeds to 1.8 angstroms resolution
Deposited on 1995-01-26, released 1996-01-15
The last revision prior to the SCOP 1.57 freeze date was dated 1996-01-15, with a file datestamp of 1996-01-17.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d2baa__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2baa_ (-)
    svssivsraqfdrmllhrndgacqakgfytydafvaaaaafpgfgttgsadaqkrevaaf
    laqtshettggwatapdgafawgycfkqergassdyctpsaqwpcapgkryygrgpiqls
    hnynygpagraigvdllanpdlvatdatvgfktaiwfwmtaqppkpsshaviagqwspsg
    adraagrvpgfgvitniinggiecghgqdsrvadrigfykrycdilgvgygnnldcysqr
    pfa