PDB entry 2ba1

View 2ba1 on RCSB PDB site
Description: Archaeal exosome core
Class: RNA binding protein
Keywords: exosome, RNAse ph, RNA degradation, exoribonuclease, RNA binding, s1 domain, zn-ribbon, archaeal, phosphorolytic
Deposited on 2005-10-13, released 2005-11-22
The last revision prior to the SCOP 1.75 freeze date was dated 2005-11-22, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.224
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Archaeal exosome RNA binding protein CSL4
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Archaeal exosome RNA binding protein CSL4
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Archaeal exosome RNA binding protein CSL4
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Archaeal exosome complex exonuclease RRP41
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1d1, d2ba1d2
  • Chain 'E':
    Compound: Archaeal exosome complex exonuclease RRP41
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1e1, d2ba1e2
  • Chain 'F':
    Compound: Archaeal exosome complex exonuclease RRP41
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1f1, d2ba1f2
  • Chain 'G':
    Compound: Archaeal exosome complex exonuclease RRP42
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1g1, d2ba1g2
  • Chain 'H':
    Compound: Archaeal exosome complex exonuclease RRP42
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1h1, d2ba1h2
  • Chain 'I':
    Compound: Archaeal exosome complex exonuclease RRP42
    Species: Archaeoglobus fulgidus
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d2ba1i1, d2ba1i2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ba1D (D:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1D (D:)
    eklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlq
    dpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifve
    vlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadmp
    faflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgeem
    deite
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ba1E (E:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1E (E:)
    eklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlq
    dpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifve
    vlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadmp
    faflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgeem
    deite
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ba1F (F:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1F (F:)
    eklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlq
    dpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifve
    vlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadmp
    faflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgeem
    deite
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ba1G (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1G (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegek
    vwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrdlpvsvtsli
    vgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdelldvsincark
    lrekfke
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ba1H (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1H (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegek
    vwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrdlpvsvtsli
    vgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdelldvsincark
    lrekfke
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ba1I (I:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba1I (I:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvpdensielarvvdrgireseavdlsklvieegek
    vwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrdlpvsvtsli
    vgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdelldvsincark
    lrekfke