PDB entry 2ba0

View 2ba0 on RCSB PDB site
Description: Archaeal exosome core
Class: RNA binding protein
Keywords: exosome, RNAse ph, RNA degradation, exoribonuclease, RNA binding, s1domain, kh domain, archaeal, RNA binding protein
Deposited on 2005-10-13, released 2005-11-22
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.216
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Archeal exosome RNA binding protein RRP4
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0a1, d2ba0a2, d2ba0a3
  • Chain 'B':
    Compound: Archeal exosome RNA binding protein RRP4
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0b1, d2ba0b2, d2ba0b3
  • Chain 'C':
    Compound: Archeal exosome RNA binding protein RRP4
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0c1, d2ba0c2, d2ba0c3
  • Chain 'D':
    Compound: Archeal exosome RNA binding protein RRP41
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0d1, d2ba0d2
  • Chain 'E':
    Compound: Archeal exosome RNA binding protein RRP41
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0e1, d2ba0e2
  • Chain 'F':
    Compound: Archeal exosome RNA binding protein RRP41
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0f1, d2ba0f2
  • Chain 'G':
    Compound: Archeal exosome RNA binding protein RRP42
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0g1, d2ba0g2
  • Chain 'H':
    Compound: Archeal exosome RNA binding protein RRP42
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0h1, d2ba0h2
  • Chain 'I':
    Compound: Archeal exosome RNA binding protein RRP42
    Species: Archaeoglobus fulgidus [TaxId:2234]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d2ba0i1, d2ba0i2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ba0A (A:)
    mrkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdv
    vigiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkm
    kvtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvn
    gdrrkvsiaeeaiylieqeahtegltdrvaefikrrkadvgiqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0A (A:)
    rkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdvv
    igiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkmk
    vtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvng
    drrkvsiaeeaiylieqeahtegltdrvaefikrrkad
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ba0B (B:)
    mrkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdv
    vigiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkm
    kvtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvn
    gdrrkvsiaeeaiylieqeahtegltdrvaefikrrkadvgiqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0B (B:)
    rkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdvv
    igiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkmk
    vtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvng
    drrkvsiaeeaiylieqeahtegltdrvaefikrrkadvgiq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ba0C (C:)
    mrkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdv
    vigiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkm
    kvtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvn
    gdrrkvsiaeeaiylieqeahtegltdrvaefikrrkadvgiqhhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0C (C:)
    rkivlpgdllstnpraagygtyveggkvyakiiglfdqtethvrviplkgrytpsvgdvv
    igiirevaangwavdiyspyqaflpvsenpemkpnkkpnevldigdaiiakvlnidpkmk
    vtltmkdricrpirfgrivainparvprvigkkgsmikllkseldvqivvgqngliwvng
    drrkvsiaeeaiylieqeahtegltdrvaefikrrkad
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ba0D (D:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0D (D:)
    klivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlqd
    pskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifvev
    lqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadmpf
    aflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgeemd
    eit
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2ba0E (E:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0E (E:)
    klivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprhlqd
    pskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidifvev
    lqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgeadmpf
    aflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievgeemd
    eit
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2ba0F (F:)
    msefnekpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgpr
    evhprhlqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfpr
    saidifvevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeed
    nfgeadmpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrr
    yievgeemdeiteggeda
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0F (F:)
    kpeklivdglrldgrkfdelrpikieasvlkradgscylemgknkviaavfgprevhprh
    lqdpskaiiryrynmapfsveerkrpgpdrrsieiskvskeafeavimkelfprsaidif
    vevlqadagsrtaclnaasvalvdagvpmkgmitsvavgkadgqlvldpmkeednfgead
    mpfaflirngkiesiallqmdgrmtrdevkqaielakkgalqiyemqreailrryievge
    emdeit
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2ba0G (G:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0G (G:)
    edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
    kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
    klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrd
    lpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdell
    dvsincarklrekfk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2ba0H (H:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0H (H:)
    edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
    kmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavdls
    klvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrd
    lpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdell
    dvsincarklrekfke
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2ba0I (I:)
    mpedilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvv
    gvkmqpgepypdtpdrgviivnaelvplasptfepgppdensielarvvdrgireseavd
    lsklvieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpv
    rdlpvsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfde
    lldvsincarklrekfkei
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ba0I (I:)
    edilvdikrdyvlsklrdneridgrgfdefrkveiipnviekaegsalvklgdtqvvvgv
    kmqpgepypdtpdrgviivnaelvplasptfeppdensielarvvdrgireseavdlskl
    vieegekvwivfvdihaldddgnlldasalaaiaalmntkvpaerfdlgedyllpvrdlp
    vsvtslivgnkylvdpsreemsvgdttltittdkddnvvamqksggylldeklfdelldv
    sincarklrekfk