PDB entry 2b9z

View 2b9z on RCSB PDB site
Description: Solution structure of FHV B2, a viral suppressor of RNAi
Class: Viral protein
Keywords: Symmetric antiparallel homodimer, all alpha-helical, Viral protein
Deposited on 2005-10-13, released 2005-11-29
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: B2 protein
    Species: Flock house virus [TaxId:12287]
    Gene: B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68831 (2-73)
      • cloning artifact (0-1)
      • see remark 999 (54)
    Domains in SCOPe 2.01: d2b9za1
  • Chain 'B':
    Compound: B2 protein
    Species: Flock house virus [TaxId:12287]
    Gene: B2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68831 (2-73)
      • cloning artifact (0-1)
      • see remark 999 (54)
    Domains in SCOPe 2.01: d2b9zb1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b9zA (A:)
gampsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvgrmvts
llekpsvvaylegk

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b9zB (B:)
gampsklaliqelpdriqtaveaamgmsyqdapnnvrrdldnlhaclnkakltvgrmvts
llekpsvvaylegk