PDB entry 2b9p

View 2b9p on RCSB PDB site
Description: 50S ribosomal subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site. This file contains the 50S subunit from a crystal structure of the ribosome in complex with tRNAs and mRNA with a stop codon in the A-site and is described in remark 400.
Class: ribosome
Keywords: ribosome, translation
Deposited on 2005-10-12, released 2006-01-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 6.46 Å
R-factor: 0.354
AEROSPACI score: -0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain '0':
    Compound: 50S ribosomal protein L27
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9p01
  • Chain '2':
    Compound: 50S ribosomal protein L29
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-End)
    Domains in SCOPe 2.03: d2b9p21
  • Chain '3':
    Compound: 50S ribosomal protein L30
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2b9p31
  • Chain '4':
    Compound: 50S ribosomal protein L31
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-72)
  • Chain '5':
    Compound: 50S ribosomal protein L32
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9p51
  • Chain '6':
    Compound: 50S ribosomal protein L33
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
  • Chain '7':
    Compound: 50S ribosomal protein L34
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-End)
    Domains in SCOPe 2.03: d2b9p71
  • Chain '8':
    Compound: 50S ribosomal protein L35
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (Start-63)
    Domains in SCOPe 2.03: d2b9p81
  • Chain '9':
    Compound: 50S ribosomal protein L36
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (Start-35)
    Domains in SCOPe 2.03: d2b9p91
  • Chain 'A':
    Compound: 23S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
    Gene:
  • Chain 'B':
    Compound: 5S ribosomal RNA
    Species: Thermus thermophilus [TaxId:274]
    Gene:
  • Chain 'D':
    Compound: 50S ribosomal protein L2
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-172)
  • Chain 'E':
    Compound: 50S ribosomal protein L3
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
  • Chain 'F':
    Compound: 50S ribosomal protein L4
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-245)
    Domains in SCOPe 2.03: d2b9pf1
  • Chain 'G':
    Compound: 50S ribosomal protein L5
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
  • Chain 'H':
    Compound: 50S ribosomal protein L6
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9ph1, d2b9ph2
  • Chain 'I':
    Compound: 50S ribosomal protein L9
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-148)
    Domains in SCOPe 2.03: d2b9pi1, d2b9pi2
  • Chain 'K':
    Compound: 50S ribosomal protein L11
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9pk1, d2b9pk2
  • Chain 'N':
    Compound: 50S ribosomal protein L13
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9pn1
  • Chain 'O':
    Compound: 50S ribosomal protein L14
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-121)
    Domains in SCOPe 2.03: d2b9po1
  • Chain 'P':
    Compound: 50S ribosomal protein L15
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
  • Chain 'Q':
    Compound: 50S ribosomal protein L16
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-137)
  • Chain 'R':
    Compound: 50S ribosomal protein L17
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2b9pr1
  • Chain 'S':
    Compound: 50S ribosomal protein L18
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
  • Chain 'T':
    Compound: 50S ribosomal protein L19
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9pt1
  • Chain 'U':
    Compound: 50S ribosomal protein L20
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (Start-117)
    Domains in SCOPe 2.03: d2b9pu1
  • Chain 'V':
    Compound: 50S ribosomal protein L21
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-99)
    Domains in SCOPe 2.03: d2b9pv1
  • Chain 'W':
    Compound: 50S ribosomal protein L22
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2b9pw1
  • Chain 'X':
    Compound: 50S ribosomal protein L23
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-End)
    Domains in SCOPe 2.03: d2b9px1
  • Chain 'Y':
    Compound: 50S ribosomal protein 24
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P (0-End)
    Domains in SCOPe 2.03: d2b9py1
  • Chain 'Z':
    Compound: 50S ribosomal protein CTC
    Species: Thermus thermophilus [TaxId:274]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 2B9P
    Domains in SCOPe 2.03: d2b9pz1

PDB Chain Sequences:

  • Chain '0':
    Sequence, based on SEQRES records: (download)
    >2b9p0 (0:)
    mahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlf
    alsdgkvvfinkgkgarfisieaaqtevaad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p0 (0:)
    ahkkgvgsskngrdsnpkylgvkkfggevvkagnilvrqrgtkfkagqgvgmgrdhtlfa
    lsdgkvvfinkgkgarfisieaaqte
    

  • Chain '2':
    Sequence, based on SEQRES records: (download)
    >2b9p2 (2:)
    tvlhvqeirdmtpaereaelddlktellnaravqaaggapenpgrikelrkaiariktiq
    geegdlqene
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p2 (2:)
    tvlhvqeirdmtpaereaelddlktellnarvqaaggapenpgrikelrkaiariktiqg
    eegd
    

  • Chain '3':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9p3 (3:)
    mprlkvklvkspigypkdqkaalkalglrrlqqervledtpairgnvekvahlvrvevve
    

  • Chain '4':
    No sequence available.

  • Chain '5':
    Sequence, based on SEQRES records: (download)
    >2b9p5 (5:)
    makhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvlav
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p5 (5:)
    akhpvpkkktskskrdmrrshhaltapnltecpqchgkklshhicpncgyydgrqvla
    

  • Chain '6':
    No sequence available.

  • Chain '7':
    Sequence, based on SEQRES records: (download)
    >2b9p7 (7:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsde
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p7 (7:)
    mkrtyqpnnrkrakthgfrarmktksgrnilarrrakgrhqltvsd
    

  • Chain '8':
    Sequence, based on SEQRES records: (download)
    >2b9p8 (8:)
    mpkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmkl
    mlpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p8 (8:)
    pkmkthkmakrrikitgtgkvmafksgkrhqntgksgdeirgkgkgfvlakaewarmklm
    lpr
    

  • Chain '9':
    Sequence, based on SEQRES records: (download)
    >2b9p9 (9:)
    mkvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9p9 (9:)
    kvrssvkkmcdnckvvrrhgrvlvicsnvkhkqrq
    

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2b9pF (F:)
    meatiydldgntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaes
    fgsgrgqahvpkldgrarrvpqavkgrsahppktekdrsldlndkerqlavrsalaatad
    adlvadrghefdrdevpvvvsddfedlvktqevvsllealdvhadidradetkikagqgs
    argrkyrrpasilfvtsdepstaarnlagadvatasevntedlapggapgrltvftesal
    aevaer
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pF (F:)
    meatiydntdgevdlpdvfetpvrsdligkavraaqanrkqdygsdeyaglrtpaesfgs
    grgqahrvpqavkgrsahppktekdrsldlndkerqlavrsalaatadvvvsddfedlvk
    tqevvsllealdvhadidrlfvtsdepstaarnlagadvatasevntedlapgrltvfte
    salaevaer
    

  • Chain 'G':
    No sequence available.

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2b9pH (H:)
    srvgkkpieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhh
    ralhgttrsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegl
    eievpsqtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrlkegktgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pH (H:)
    pieipagvtvtvngntvtvkgpkgeltrtfhpdmtitvegnvitvtrpsdekhhralhgt
    trsllanmvegvskgyekalelvgvgyraskqgkklvlsvgyshpveiepeegleievps
    qtkiivkgadkqrvgelaaniravrppepykgkgiryegelvrl
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2b9pI (I:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
    elanakklkeqlekltvtipakageggrlfgsitskqiaeslqaqhglkldkrkielada
    iralgytnvpvklhpevtatlkvhvteqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pI (I:)
    mkviflkdvkgkgkkgeiknvadgyannflfkqglaieatpanlkaleaqkqkeqrqaae
    elanakklkeqlekltvtipakagegrlfgsitskqiaeslqaqhglkldkrkieladai
    ralgytnvpvklhpevtatlkvhvteqk
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2b9pK (K:)
    makkvaaqiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitv
    yedksftfiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnans
    leaamkiiegtaksmgievvd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pK (K:)
    qiklqlpagkatpappvgpalgqhgvnimefckrfnaetadkagmilpvvitvyedksft
    fiiktppasfllkkaagiekgssepkrkivgkvtrkqieeiaktkmpdlnansleaamki
    iegtaksmgievv
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2b9pN (N:)
    msvaefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekr
    vdigndngyfypkrpdgifkrtirgmlphkkqrgreafesvrvylgnpydedgevldgts
    ldrlsnikfvtlgeisetlganktw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pN (N:)
    aefdadvivdardcimgrvasqvaeqaldgetvavvnaeravitgreeqivekyekrvdi
    gndngyfypkrpdgifkrtirgmlpkkqrgreafesvrvylgnpydtlgeisetlga
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9pO (O:)
    miqqesrlkvadnsgarevlvikvlggsgrryanigdvvvatvkdatpggvvkkgqvvka
    vvvrtkrgvrrpdgsyirfdenacviirddksprgtrifgpvarelrdkdfmkiislape
    vi
    

  • Chain 'P':
    No sequence available.

  • Chain 'Q':
    No sequence available.

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2b9pR (R:)
    mrhlksgrklnrhsshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdl
    harrlvlrdlqdvklvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pR (R:)
    sshrlalyrnqaksllthgritttvpkakelrgfvdhlihlakrgdlharrlvlrdlqdv
    klvrklfdeiapryrdrqggytrvlklaerrrgdgaplalvelve
    

  • Chain 'S':
    No sequence available.

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2b9pT (T:)
    prtrecdycgtdiepgtgtmfvhkdgatthfcsskcennadlgrearnlewtdtargeag
    eaedea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pT (T:)
    recdycgtdiepgtgtmfvhkdgatthfcsskcennadlrearnlewtdtar
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2b9pU (U:)
    mpraktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrl
    wiqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pU (U:)
    praktgivrrrrhkkvlkrakgfwgsrskqyrnafqtllnaatyeyrdrrnkkrdfrrlw
    iqrinagarlhgmnystfinglkranidlnrkvladiaarepeafkalvdasrnarq
    

  • Chain 'V':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9pV (V:)
    mfaiiqtggkqyrvsegdvirveslqgeagdkvelkalfvggeqtvfgedagkytvqaev
    vehgrgkkiyirkyksgvqyrrrtghrqnftaikilgiqg
    

  • Chain 'W':
    Sequence, based on SEQRES records: (download)
    >2b9pW (W:)
    meakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavn
    nhdmledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgekhgk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pW (W:)
    eakaiaryvrisprkvrlvvdlirgksleearnilrytnkrgayfvakvlesaaanavnn
    hdledrlyvkaayvdegpalkrvlprargradiikkrtshitvilgek
    

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2b9pX (X:)
    swdvikhphvtekamndmdfqnklqfavddraskgevadaveeqydvtveqvntqntmdg
    ekkavvrlsedddaqevasrigvf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pX (X:)
    swdvikhphvtekamndmdfnklqfavddraskgevadaveeqydvtveqvntqntmdge
    kkavvrlsedddqeva
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >2b9pY (Y:)
    skqpdkqrksqrraplherhkqvratlsadlreeygqrnvrvnagdtvevlrgdfageeg
    evinvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearleseddsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pY (Y:)
    skqpdkqrksqrraplherhkqvratlsadlreeygvrvnagdtvevlrgdfageegevi
    nvdldkavihvedvtlektdgeevprpldtsnvrvtdldledekrearle
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >2b9pZ (Z:)
    mahtgqtaksqgdtatmeltakprtpkqkldesmiaavaynkennvsfaldrkafdrafr
    qqsttglfditveggetfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrs
    qgevqgglvdivvhnlqivapgprripqelvvdvtkmnigdhitagdiklpegctlaadp
    eltvvsvlpprltaeeleaevqaaqvaglvaagelseeaaeavlegdasleevkaeased
    nagtdsednsdaq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9pZ (Z:)
    meltakprtpkqkldesmiaavaynkennvsfaldrkafdrafrqqsttglfditvegge
    tfpalvkavqmdkrkrapihvdfymvtygepvevsvpvhttgrsqgevqgglvdivvhnl
    qivapgprripqelvvdvtkmnigdhitagdiklpegctlaadpeltvvsvlpprlt