PDB entry 2b9o

View 2b9o on RCSB PDB site
Description: 30S ribosomal subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site. This file contains the 30S subunit, tRNAs and mRNA from a crystal structure of the whole ribosomal complex with a stop codon in the A-site and is described in remark 400.
Class: ribosome
Keywords: ribosome, translation
Deposited on 2005-10-12, released 2006-01-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 6.46 Å
R-factor: 0.354
AEROSPACI score: -0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 16S ribosomal RNA
    Species: Thermus thermophilus [TaxId:300852]
  • Chain 'B':
    Compound: 30S ribosomal protein S2
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9ob1
  • Chain 'C':
    Compound: 30S ribosomal protein S3
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oc1, d2b9oc2
  • Chain 'D':
    Compound: 30S ribosomal protein S4
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9od1
  • Chain 'E':
    Compound: 30S ribosomal protein S5
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oe1, d2b9oe2
  • Chain 'F':
    Compound: 30S ribosomal protein S6
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9of1
  • Chain 'G':
    Compound: 30S ribosomal protein S7
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9og1
  • Chain 'H':
    Compound: 30S ribosomal protein S8
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oh1
  • Chain 'I':
    Compound: 30S ribosomal protein S9
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oi1
  • Chain 'J':
    Compound: 30S ribosomal protein S10
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oj1
  • Chain 'K':
    Compound: 30S ribosomal protein S11
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9ok1
  • Chain 'L':
    Compound: 30S ribosomal protein S12
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • GB YP_144963
    Domains in SCOPe 2.01: d2b9ol1
  • Chain 'M':
    Compound: 30S ribosomal protein S13
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9om1
  • Chain 'N':
    Compound: 30S ribosomal protein S14
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9on1
  • Chain 'O':
    Compound: 30S ribosomal protein S15
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oo1
  • Chain 'P':
    Compound: 30S ribosomal protein S16
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9op1
  • Chain 'Q':
    Compound: 30S ribosomal protein S17
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9oq1
  • Chain 'R':
    Compound: 30S ribosomal protein S18
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9or1
  • Chain 'S':
    Compound: 30S ribosomal protein S19
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9os1
  • Chain 'T':
    Compound: 30S ribosomal protein S20
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9ot1
  • Chain 'U':
    Compound: 30S ribosomal protein Thx
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b9ou1
  • Chain 'V':
    Compound: P-site tRNA (Phe)
    Species: Escherichia coli [TaxId:562]
  • Chain 'W':
    Compound: E-site tRNA (Phe)
    Species: Escherichia coli [TaxId:562]
  • Chain 'X':
    Compound: 5'-d(*ap*up*gp*up*up*cp*up*ap*gp*up*ap*cp*ap*ap*up*ap*ap*u)-3'
    Species: synthetic, synthetic

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b9oB (B:)
    mpveitvkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfied
    lamrggtilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelea
    lfaspeieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearkl
    fipvialadtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    eaeatetpegesevea
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oB (B:)
    vkelleagvhfgherkrwnpkfaryiyaerngihiidlqktmeelertfrfiedlamrgg
    tilfvgtkkqaqdivrmeaeragmpyvnqrwlggmltnfktisqrvhrleelealfaspe
    ieerpkkeqvrlkhelerlqkylsgfrllkrlpdaifvvdptkeaiavrearklfipvia
    ladtdsdpdlvdyiipgnddairsiqlilsravdliiqarggvvepspsyalvq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b9oC (C:)
    mgnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdiera
    adnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrv
    aeqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlra
    nidygfalarttygvlgvkayiflgeviggqkpkarpelpkaeerprrrrpavrvkkee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oC (C:)
    gnkihpigfrlgitrdwesrwyagkkqyrhllledqrirgllekelysaglarvdieraa
    dnvavtvhvakpgvvigrggerirvlreelakltgknvalnvqevqnpnlsaplvaqrva
    eqierrfavrraikqavqrvmesgakgakvivsgriggaeqartewaaqgrvplhtlran
    idygfalarttygvlgvkayiflgev
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b9oD (D:)
    mgryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlre
    kqklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarql
    vrhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldveg
    mkgkflrlpdredlalpvneqlviefysr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oD (D:)
    gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
    qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
    rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
    kgkflrlpdredlalpvneqlviefysr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2b9oE (E:)
    mpetdfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagy
    yarrnmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdilt
    kelgsrnpiniayatmealrqlrtkadverlrkgeahaqaqg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oE (E:)
    dfeekmilirrtarmqaggrrfrfgalvvvgdrqgrvglgfgkapevplavqkagyyarr
    nmvevplqngtipheievefgaskivlkpaapgtgviagavprailelagvtdiltkelg
    srnpiniayatmealrqlrtkadverlrkg
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9oF (F:)
    mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf
    lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2b9oG (G:)
    marrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplk
    vfkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavri
    ahelmdaaegkggavkkkedvermaeanrayahyrw
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oG (G:)
    arrrraevrqlqpdlvygdvlvtafinkimrdgkknlaarifydackiiqektgqeplkv
    fkqavenvkprmevrsrrvgganyqvpmevsprrqqslalrwlvqaanqrperraavria
    helmdaaegkggavkkkedvermaeanrayahyrw
    

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b9oH (H:)
    mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr
    vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt
    drearklgvggelicevw
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2b9oI (I:)
    meqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfd
    ayitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkar
    rapqyskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oI (I:)
    eqyygtgrrkeavarvflrpgngkvtvngqdfneyfqglvravaaleplravdalgrfda
    yitvrgggksgqidaiklgiaralvqynpdyraklkplgfltrdarvverkkygkhkarr
    apqyskr
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2b9oJ (J:)
    mpkiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsr
    ehfelrthnrlvdiinpnrktieqlmtldlptgveieiktvgggr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oJ (J:)
    kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
    felrthnrlvdiinpnrktieqlmtldlptgveieikt
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2b9oK (K:)
    makkpskkkvkrqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpya
    aqlaaldaakkamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcr
    pkkkfrkas
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oK (K:)
    krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
    kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2b9oL (L:)
    mvalptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrl
    tsgyevtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrsky
    gtkkpkeaaktaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oL (L:)
    ptinqlvrkgrekvrkkskvpalkgapfrrgvctvvrtvtpkkpnsalrkvakvrltsgy
    evtayipgeghnlqehsvvlirggrvkdlpgvryhivrgvydaagvkdrkksrskygtkk
    pkea
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2b9oM (M:)
    mariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyv
    entwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagk
    kkaprk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oM (M:)
    ariagveiprnkrvdvaltyiygigkarakealektginpatrvkdlteaevvrlreyve
    ntwklegelraevaanikrlmdigcyrglrhrrglpvrgqrtrtnartrkgprktvagkk
    kaprk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2b9oN (N:)
    markaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkas
    w
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oN (N:)
    arkaliekakrtpkfkvraytrcvrcgrarsvyrffglcriclrelahkgqlpgvrkasw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2b9oO (O:)
    mpitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmv
    gqrrrllrylqredperyralieklgirg
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oO (O:)
    pitkeekqkviqefarfpgdtgstevqvalltlrinrlsehlkvhkkdhhshrgllmmvg
    qrrrllrylqredperyralieklgirg
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2b9oP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqearega
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oP (P:)
    mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
    svgaqptdtarrllrqagvfrqe
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2b9oQ (Q:)
    mpkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveii
    esrpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oQ (Q:)
    pkkvltgvvvsdkmqktvtvlverqfphplygkvikrskkylahdpeekyklgdvveiie
    srpiskrkrfrvlrlvesgrmdlvekylirrqnyqslskrggka
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2b9oR (R:)
    mstknakpkkeaqrrpsrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsg
    keqrilaktikrarilgllpfteklvrk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oR (R:)
    psrkakvkatlgefdlrdyrnvevlkrflsetgkilprrrtglsgkeqrilaktikrari
    lgllpfteklvrk
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2b9oS (S:)
    mprslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpv
    yitenmvghklgefaptrtyrghgkeakatkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oS (S:)
    prslkkgvfvddhllekvlelnakgekrliktwsrrstivpemvghtiavyngkqhvpvy
    itenmvghklgefaptrtyr
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2b9oT (T:)
    maqkkpkrnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkae
    slidkaakgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oT (T:)
    rnlsalkrhrqslkrrlrnkakksaiktlskkavqlaqegkaeealkimrkaeslidkaa
    kgstlhknaaarrksrlmrkvrqlleaagapliggglsa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2b9oU (U:)
    mgkgdrrtrrgkiwrgtygkyrprkkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b9oU (U:)
    gkgdrrtrrgkiwrgtygkyrprk
    

  • Chain 'V':
    No sequence available.

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.