PDB entry 2b97

View 2b97 on RCSB PDB site
Description: Ultra-high resolution structure of hydrophobin HFBII
Class: surface active protein
Keywords: hydrophobin, ultra-high resolution, surfactant, amphiphilic, SURFACE ACTIVE PROTEIN
Deposited on 2005-10-11, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.75 Å
R-factor: 0.13
AEROSPACI score: 1.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hydrophobin II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b97a_
  • Chain 'B':
    Compound: Hydrophobin II
    Species: Hypocrea jecorina [TaxId:51453]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b97b_
  • Heterogens: MN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b97A (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b97A (A:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b97B (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigtf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b97B (B:)
    avcptglfsnplccatnvldligvdcktptiavdtgaifqahcaskgskplccvapvadq
    allcqkaigt