PDB entry 2b95

View 2b95 on RCSB PDB site
Description: Solution NMR structure of protein dynein light chain 2A, cytoplasmic; Northeast structural genomics consortium TARGET HR2106
Class: transport protein
Keywords: Dynein light chain 2A, cytoplasmic, homodimer, NMR, Structural Genomics, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, TRANSPORT PROTEIN
Deposited on 2005-10-10, released 2005-11-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Dynein light chain 2A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b95a1
  • Chain 'B':
    Compound: Dynein light chain 2A
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b95b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b95A (A:)
    mghhhhhhshmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b95A (A:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b95B (B:)
    mghhhhhhshmaeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfi
    lkarstvrdidpqndltflrirskkneimvapdkdyfliviqnpte
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b95B (B:)
    maeveetlkrlqsqkgvqgiivvntegipikstmdnptttqyaslmhsfilkarstvrdi
    dpqndltflrirskkneimvapdkdyfliviqnpte