PDB entry 2b90

View 2b90 on RCSB PDB site
Description: Crystal structure of the interleukin-4 variant T13DR85A
Class: cytokine
Keywords: four helix bundle, CYTOKINE
Deposited on 2005-10-10, released 2006-05-30
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.216
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interleukin-4
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05112 (0-128)
      • engineered (12)
      • engineered (84)
    Domains in SCOPe 2.01: d2b90a_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b90A (A:)
    hkcditlqeiikdlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
    kdtrclgataqqfhrhkqlirflkaldrnlwglaglnscpvkeanqstlenflerlktim
    rekyskcss