PDB entry 2b8y

View 2b8y on RCSB PDB site
Description: Crystal structure of the interleukin-4 variant T13DF82D
Class: cytokine
Keywords: Four Helix Bundle, CYTOKINE
Deposited on 2005-10-10, released 2006-05-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.218
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: interleukin-4
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P05112 (0-128)
    • engineered (12)
    • engineered (81)
  Domains in SCOPe 2.08: d2b8ya_
• Heterogens: SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b8yA (A:)
  hkcditlqeiikdlnslteqktlcteltvtdifaaskntteketfcraatvlrqfyshhe
  kdtrclgataqqfhrhkqlirdlkrldrnlwglaglnscpvkeanqstlenflerlktim
  rekyskcss