PDB entry 2b8p

View 2b8p on RCSB PDB site
Description: Crystal structure of Acanthamoeba polyphaga mimivirus NDK, the first viral nucleoside diphosphate kinase
Class: transferase
Keywords: NDK, phosphotransferase, nucleotide binding
Deposited on 2005-10-10, released 2005-11-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.202
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable nucleoside diphosphate kinase
    Species: Mimivirus [TaxId:315393]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UQL3 (21-End)
      • expression tag (15-20)
    Domains in SCOPe 2.07: d2b8pa1, d2b8pa2
  • Chain 'B':
    Compound: Probable nucleoside diphosphate kinase
    Species: Mimivirus [TaxId:315393]
    Gene: ndk
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5UQL3 (21-End)
      • expression tag (19-20)
    Domains in SCOPe 2.07: d2b8pb1, d2b8pb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b8pA (A:)
    syyhhhhhhlestslykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwsk
    aprnlieqhykehseqsyfndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirg
    dlandirenlihasdsedsavdeisiwfpetkmetdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b8pA (A:)
    ykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykeyfn
    dncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdsedsa
    vdeisiwfp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b8pB (B:)
    syyhhhhhhlestslykkaglqrtlvlikpdaferslvaeimgriekknfkivsmkfwsk
    aprnlieqhykehseqsyfndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirg
    dlandirenlihasdsedsavdeisiwfpetkmetdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b8pB (B:)
    glqrtlvlikpdaferslvaeimgriekknfkivsmkfwskaprnlieqhykehseqsyf
    ndncdfmvsgpiisivyegtdaiskirrlqgniltpgtirgdlandirenlihasdseds
    avdeisiwfp