PDB entry 2b8l

View 2b8l on RCSB PDB site
Description: Crystal structure of human beta secretase complexed with inhibitor
Class: hydrolase
Keywords: aspartyl protease, bace, hydrolase
Deposited on 2005-10-07, released 2005-10-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.23
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-secretase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: BACE1, BACE
    Database cross-references and differences (RAF-indexed):
    • Uniprot P56817 (49-404)
      • initiating methionine (48)
      • engineered (94)
      • engineered (96)
    Domains in SCOPe 2.01: d2b8la_
  • Heterogens: 5HA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b8lA (A:)
    mlpretdeepeepgrrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfav
    gaaphpflhryyqrqlsstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvrania
    aitesdkffingsnwegilglayaeiarpddslepffdslvkqthvpnlfslqlcgagfp
    lnqsevlasvggsmiiggidhslytgslwytpirrewyyeviivrveingqdlkmdckey
    nydksivdsgttnlrlpkkvfeaavksikaasstekfpdgfwlgeqlvcwqagttpwnif
    pvislylmgevtnqsfritilpqqylrpvedvatsqddcykfaisqsstgtvmgavimeg
    fyvvfdrarkrigfavsachvhdefrtaavegpfvtldmedcgyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b8lA (A:)
    rrgsfvemvdnlrgksgqgyyvemtvgsppqtlnilvdtgssnfavgaaphpflhryyqr
    qlsstyrdlrkgvyvpytqgawagelgtdlvsiphgpnvtvraniaaitesdkffingsn
    wegilglayaeiarpddslepffdslvkqthvpnlfslqlcgavggsmiiggidhslytg
    slwytpirrewyyeviivrveingqdlkmdckeynydksivdsgttnlrlpkkvfeaavk
    sikaasstekfpdgfwlgeqlvcwqagttpwnifpvislylmgevtnqsfritilpqqyl
    rpvedvatsqddcykfaisqsstgtvmgavimegfyvvfdrarkrigfavsachvhdefr
    taavegpfvtldmedcgyn