PDB entry 2b8j

View 2b8j on RCSB PDB site
Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate at 2 A resolution
Class: hydrolase
Keywords: Class B acid phosphatase; DDDD acid phosphatase; metallo-enzyme; AMP, HYDROLASE
Deposited on 2005-10-07, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.03 Å
R-factor: 0.175
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b8ja_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b8jb_
  • Heterogens: MG, SPM, PO4, AU, AU3, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8jA (A:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8jB (B:)
    spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
    tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
    vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
    girilrasnstykplpqagafgeevivnsey