PDB entry 2b8h

View 2b8h on RCSB PDB site
Description: A/NWS/whale/Maine/1/84 (H1N9) reassortant influenza virus neuraminidase
Class: Hydrolase
Keywords: 6-bladed beta-propeller, Hydrolase
Deposited on 2005-10-07, released 2006-09-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.141
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-387)
      • conflict (286)
    Domains in SCOPe 2.07: d2b8ha_
  • Chain 'B':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-387)
      • conflict (286)
    Domains in SCOPe 2.07: d2b8hb_
  • Chain 'C':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-387)
      • conflict (286)
    Domains in SCOPe 2.07: d2b8hc_
  • Chain 'D':
    Compound: Neuraminidase
    Species: Influenza A virus [TaxId:11320]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P05803 (0-387)
      • conflict (286)
    Domains in SCOPe 2.07: d2b8hd_
  • Heterogens: NAG, SO4, CL, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8hA (A:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
    altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8hB (B:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
    altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8hC (C:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
    altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8hD (D:)
    refnnltkglctinswhiygkdnavrigedsdvlvtrepyvscdpdecrfyalsqgttir
    gkhsngtihdrsqyrdliswplsspptvynsrvecigwsstschdgrarmsicisgpnnn
    asaviwynrrpvteintwarnilrtqesecvcqngvcpvvftdgsatgpaetriyyfkeg
    kilkwepltgtakhieecscygeqagvtctcrdnwqgsnrpviqidpvamthtsqyicsp
    vltdnprpndptvgkcndpypgnnnngvkgfsyldggntwlgrtisvasrsgyemlkvpn
    altddrskptqgqtivlntdwsgysgsfmdywaegecyracfyvelirgrpkedkvwwts
    nsivsmcssteflgqwnwpdgakieyfl