PDB entry 2b8a

View 2b8a on RCSB PDB site
Description: High Resolution Structure of the HDGF PWWP Domain
Class: hormone/growth factor
Keywords: pwwp, hdgf, hormone/growth factor complex
Deposited on 2005-10-06, released 2005-12-06
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatoma-derived growth factor
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Hdgf
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d2b8aa1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b8aA (A:)
    msrsnrqkeykcgdlvfakmkgyphwparidempeaavkstankyqvfffgthetaflgp
    kdlfpyeeskekfgkpnkrkgfseglweiennptvkasgyqssqkkscae