PDB entry 2b88

View 2b88 on RCSB PDB site
Description: Structural basis for molecular recognition in an affibody:affibody complex
Class: protein binding
Keywords: protein-protein interactions, protein engineering, molecular recognition, nmr spectroscopy,induced fit, affibody, protein binding
Deposited on 2005-10-06, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZTaq affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b88a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b88A (A:)
    vdnkfnkelgwatweifnlpnlngvqvkafidslrddpsqsanllaeakklndaqapk