PDB entry 2b87

View 2b87 on RCSB PDB site
Description: Structural basis for molecular recognition in an affibody:affibody complex
Class: protein binding
Keywords: protein-protein interactions protein engineering, molecular recognition, nmr spectroscopy, induced fit, affibody, protein binding
Deposited on 2005-10-06, released 2006-05-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.06 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ZTaq affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b87a_
  • Chain 'B':
    Compound: anti-ZTaq affibody
    Species: Staphylococcus aureus [TaxId:1280]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b87b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b87A (A:)
    vdnkfnkelgwatweifnlpnlngvqvkafidslrddpsqsanllaeakklndaqapk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b87B (B:)
    vdnkfnkerviaigeimrlpnlnslqvvafinslrddpsqsanllaeakklndaqapk