PDB entry 2b83

View 2b83 on RCSB PDB site
Description: A single amino acid substitution in the Clostridium beijerinckii alcohol dehydrogenase is critical for thermostabilization
Class: oxidoreductase
Keywords: CbADH MUTANT, Metal binding, Structural Genomics, Israel Structural Proteomics Center, ISPC, OXIDOREDUCTASE
Deposited on 2005-10-06, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.193
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25984 (0-350)
      • engineered (99)
    Domains in SCOPe 2.07: d2b83a1, d2b83a2
  • Chain 'B':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25984 (0-350)
      • engineered (99)
    Domains in SCOPe 2.07: d2b83b1, d2b83b2
  • Chain 'C':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25984 (0-350)
      • engineered (99)
    Domains in SCOPe 2.07: d2b83c1, d2b83c2
  • Chain 'D':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Clostridium beijerinckii [TaxId:1520]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P25984 (0-350)
      • engineered (99)
    Domains in SCOPe 2.07: d2b83d1, d2b83d2
  • Heterogens: ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b83A (A:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b83B (B:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b83C (C:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b83D (D:)
    mkgfamlginklgwiekerpvagsydaivrplavspctsdihtvfegalgdrknmilghe
    avgevvevgsevkdfkpgdrvivpcttpdwrslevqagfpqhsngmlagwkfsnfkdgvf
    geyfhvndadmnlailpkdmplenavmitdmmttgfhgaeladiqmgssvvvigigavgl
    mgiagaklrgagriigvgsrpicveaakfygatdilnyknghivdqvmkltngkgvdrvi
    magggsetlsqavsmvkpggiisninyhgsgdalliprvewgcgmahktikgglcpggrl
    raemlrdmvvynrvdlsklvthvyhgfdhieealllmkdkpkdlikavvil