PDB entry 2b82

View 2b82 on RCSB PDB site
Description: Crystal structure of AphA class B acid phosphatase/phosphotransferase ternary complex with adenosine and phosphate bound to the catalytic metal at 1.2 A resolution
Class: hydrolase
Keywords: Class B acid phosphatase; DDDD acid phosphatase; metallo-enzyme; AMP, HYDROLASE
Deposited on 2005-10-06, released 2005-11-29
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.25 Å
R-factor: 0.167
AEROSPACI score: 0.79 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b82a_
  • Chain 'B':
    Compound: Class B acid phosphatase
    Species: Escherichia coli [TaxId:562]
    Gene: aphA, napA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b82b_
  • Heterogens: MG, PO4, ADN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b82A (A:)
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b82B (B:)
spsplnpgtnvarlaeqapihwvsvaqienslagrppmavgfdiddtvlfsspgfwrgkk
tfspesedylknpvfwekmnngwdefsipkevarqlidmhvrrgdaiffvtgrsptktet
vsktladnfhipatnmnpvifagdkpgqntksqwlqdknirifygdsdnditaardvgar
girilrasnstykplpqagafgeevivnsey