PDB entry 2b7t

View 2b7t on RCSB PDB site
Description: Structure of ADAR2 dsRBM1
Class: hydrolase
Keywords: RNA editing, RNA-binding protein
Deposited on 2005-10-05, released 2006-03-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-14, with a file datestamp of 2007-06-04.
Experiment type: NMR20
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific editase 1
    Species: Rattus norvegicus
    Gene: Adarb1, Red1
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b7ta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >2b7tA (A:)
pgpvlpknalmqlneikpglqymllsqtgpvhaplfvmsvevngqvfegsgptkkkaklh
aaekalrsfvqfp