PDB entry 2b7t

View 2b7t on RCSB PDB site
Description: Structure of ADAR2 dsRBM1
Class: hydrolase
Keywords: RNA editing, RNA-binding protein, HYDROLASE
Deposited on 2005-10-05, released 2006-03-14
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Double-stranded RNA-specific editase 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Adarb1, Red1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b7ta1

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b7tA (A:)
    pgpvlpknalmqlneikpglqymllsqtgpvhaplfvmsvevngqvfegsgptkkkaklh
    aaekalrsfvqfp