PDB entry 2b7s

View 2b7s on RCSB PDB site
Description: R381K mutant of flavocytochrome c3
Class: oxidoreductase
Keywords: flavocytochrome c3, fumarate reductase, proton delivery, OXIDOREDUCTASE
Deposited on 2005-10-05, released 2006-05-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.12 Å
R-factor: 0.147
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Shewanella frigidimarina [TaxId:56812]
    Gene: FCC
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q02469 (0-End)
      • engineered (380)
    Domains in SCOPe 2.07: d2b7sa1, d2b7sa2, d2b7sa3
  • Heterogens: NA, HEM, FAD, FUM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b7sA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavkgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakyskkn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b7sA (A:)
    adnlaefhvqnqecdschtpdgelsndsltyentqcvschgtlaevaettkhehynahas
    hfpgevactschsaheksmvycdschsfdfnmpyakkwlrdeptiaelakdkserqaala
    saphdtvdvvvvgsggagfsaaisatdsgakviliekepviggnaklaaggmnaawtdqq
    kakkitdspelmfedtmkggqnindpalvkvlsshskdsvdwmtamgadltdvgmmggas
    vnrahrptggagvgahvvqvlydnavkrnidlrmntrgievlkddkgtvkgilvkgmykg
    yywvkadavilatggfaknnervakldpslkgfistnqpgavgdgldvaenaggalkdmq
    yiqahptlsvkggvmvteavkgngailvnregkrfvneittrdkasaailaqtgksayli
    fddsvrkslskidkyiglgvaptadslvklgkmegidgkaltetvarynslvssgkdtdf
    erpnlpralnegnyyaievtpgvhhtmggvmidtkaevmnakkqvipglygagevtggvh
    ganrlggnaisdiitfgrlageeaakys