PDB entry 2b7o

View 2b7o on RCSB PDB site
Description: The Structure of 3-Deoxy-D-Arabino-Heptulosonate 7-Phosphate Synthase from Mycobacterium tuberculosis
Class: transferase
Keywords: Mycobacterium tuberculosis, DAH7PS synthase, Shikimate pathway, aromatic biosynthesis, evolutionary relationships, Structural Genomics, Mycobacterium Tuberculosis Structural Proteomics Project, XMTB, TRANSFERASE
Deposited on 2005-10-05, released 2005-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.19
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase arog
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53512 (2-463)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2b7oa1, d2b7oa2
  • Chain 'B':
    Compound: 3-deoxy-d-arabino-heptulosonate 7-phosphate synthase arog
    Species: Mycobacterium tuberculosis [TaxId:83332]
    Gene: Rv2178c
    Database cross-references and differences (RAF-indexed):
    • Uniprot O53512 (2-463)
      • expression tag (0-1)
    Domains in SCOPe 2.07: d2b7ob2, d2b7ob3
  • Heterogens: MN, SO4, PEP, CE1, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b7oA (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b7oA (A:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    lagryetacdprlntqqslelaflvaemlrd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b7oB (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesstgfktrhfdrivdevqgffevhralgthpggihveitgenvt
    eclggaqdisetdlagryetacdprlntqqslelaflvaemlrd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b7oB (B:)
    gamnwtvdipidqlpslpplptdlrtrldaalakpaaqqptwpadqalamrtvlesvppv
    tvpseivrlqeqlaqvakgeafllqggdcaetfmdntephirgnvrallqmavvltygas
    mpvvkvariagqyakprsadidalglrsyrgdmingfapdaaarehdpsrlvrayanasa
    amnlvraltssglaslhlvhdwnrefvrtspagaryealateidrglrfmsacgvadrnl
    qtaeiyashealvldyeramlrlsdgddgepqlfdlsahtvwigertrqidgahiafaqv
    ianpvgvklgpnmtpelaveyverldphnkpgrltlvsrmgnhkvrdllppivekvqatg
    hqviwqcdpmhgnthesfktrhfdrivdevqgffevhralgthpggihveitgenvtecl
    lagryetacdprlntqqslelaflvaemlrd