PDB entry 2b7h

View 2b7h on RCSB PDB site
Description: Hemoglobin from Cerdocyon thous, a canidae from Brazil, at 2.2 Angstroms resolution
Class: oxygen storage/transport
Keywords: hemoglobin, aquomet, X-ray crystallography, Cerdocyon thous
Deposited on 2005-10-04, released 2006-09-12
The last revision prior to the SCOP 1.73 freeze date was dated 2006-09-12, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.169
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hemoglobin alpha chain
    Species: Dusicyon thous
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b7ha1
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Dusicyon thous
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: hemoglobin alpha chain
    Species: Dusicyon thous
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b7hc1
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Dusicyon thous
    Gene:
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b7hA (A:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b7hC (C:)
    vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
    kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
    vhasldkfftavstvltskyr
    

  • Chain 'D':
    No sequence available.