PDB entry 2b7e

View 2b7e on RCSB PDB site
Description: First FF domain of Prp40 Yeast Protein
Class: structural protein
Keywords: structural protein
Deposited on 2005-10-04, released 2005-11-01
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Pre-mRNA processing protein PRP40
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Gene: PRP40
  Database cross-references and differences (RAF-indexed):
  • Uniprot P33203 (3-58)
    • cloning artifact (0-2)
  Domains in SCOPe 2.06: d2b7ea1, d2b7ea2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b7eA (A:)
  gameaekefitmlkenqvdstwsfsriiselgtrdprywmvdddplwkkemfekylsnr