PDB entry 2b7c

View 2b7c on RCSB PDB site
Description: Yeast guanine nucleotide exchange factor eEF1Balpha K205A mutant in complex with eEF1A
Class: translation
Keywords: G-protein/GEF complex, eEF1A, eEF1Balpha, TRANSLATION
Deposited on 2005-10-04, released 2006-05-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.21
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Elongation factor 1-alpha
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b7ca1, d2b7ca2, d2b7ca3
  • Chain 'B':
    Compound: elongation factor-1 beta
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: TEF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P32471 (Start-93)
      • engineered (92)
    Domains in SCOPe 2.07: d2b7cb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b7cA (A:)
    mgkekshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvl
    dklkaerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggv
    gefeagiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvg
    ynpktvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrpt
    dkplrlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqg
    vpgdnvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvld
    chtahiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplg
    rfavrdmrqtvavgviksvdktekaakvtkaaqkaakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b7cA (A:)
    kshinvvvighvdsgkstttghliykcggidkrtiekfekeaaelgkgsfkyawvldklk
    aerergitidialwkfetpkyqvtvidapghrdfiknmitgtsqadcailiiaggvgefe
    agiskdgqtrehallaftlgvrqlivavnkmdsvkwdesrfqeivketsnfikkvgynpk
    tvpfvpisgwngdnmieattnapwykgweketkagvvkgktlleaidaieqpsrptdkpl
    rlplqdvykiggigtvpvgrvetgvikpgmvvtfapagvttevksvemhheqleqgvpgd
    nvgfnvknvsvkeirrgnvcgdakndppkgcasfnatvivlnhpgqisagyspvldchta
    hiacrfdellekndrrsgkkledhpkflksgdaalvkfvpskpmcveafseypplgrfav
    rdmrqtvavgviksvdk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b7cB (B:)
    kpakpaaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqinc
    vveddkvslddlqqsieededhvqstdiaamqal
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b7cB (B:)
    paaksivtldvkpwddetnleemvanvkaiemegltwgahqfipigfgikklqincvved
    dkvslddlqqsieededhvqstdiaamqal