PDB entry 2b79

View 2b79 on RCSB PDB site
Description: Crystal Structure of SMU.440 from Streptococcus mutans
Class: structural genomics, unknown function
Keywords: caries, structure genomics, putative protein, UNKNOWN FUNCTION, STRUCTURAL GENOMICS
Deposited on 2005-10-03, released 2006-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-08-25, with a file datestamp of 2009-08-21.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein SMU.440
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DVN6 (6-End)
      • expression tag (1-5)
    Domains in SCOPe 2.07: d2b79a2, d2b79a3
  • Chain 'B':
    Compound: hypothetical protein SMU.440
    Species: Streptococcus mutans [TaxId:1309]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8DVN6 (6-End)
      • expression tag (0-5)
    Domains in SCOPe 2.07: d2b79b2, d2b79b3
  • Heterogens: NH4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b79A (A:)
    qmgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmed
    mpelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeal
    aflkqifadvpesvgklkqiletv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b79A (A:)
    mgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmedm
    pelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeala
    flkqifadvpesvgklkqilet
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b79B (B:)
    qmgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmed
    mpelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeal
    aflkqifadvpesvgklkqiletv
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b79B (B:)
    qmgrgsmkfsfelavntkkedawtyysqvnqwfvwegdleqislegefttgqkgkmkmed
    mpelaftlvevrenqcfsdltatpfgnvlfeheilenpdgtislrhsvsltdsdtteeal
    aflkqifadvpesvgklkqilet