PDB entry 2b76

View 2b76 on RCSB PDB site
Description: E. coli Quinol fumarate reductase FrdA E49Q mutation
Class: oxidoreductase
Keywords: fumarate reductase, succinate dehydrogenase, electron transfer, respiration, krebs cycle, membrane protein
Deposited on 2005-10-03, released 2006-02-21
The last revision prior to the SCOP 1.73 freeze date was dated 2006-05-02, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.248
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli
    Gene: FrdA
    Database cross-references and differences (RAF-indexed):
    • GB FRDA_ECOLI (0-End)
      • engineered (49)
    Domains in SCOP 1.73: d2b76a1, d2b76a2, d2b76a3
  • Chain 'B':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli
    Gene: frdB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76b1, d2b76b2
  • Chain 'C':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli
    Gene: frdC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76c1
  • Chain 'D':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli
    Gene: frdD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76d1
  • Chain 'M':
    Compound: Fumarate reductase flavoprotein subunit
    Species: Escherichia coli
    Gene: FrdA
    Database cross-references and differences (RAF-indexed):
    • GB FRDA_ECOLI (0-End)
      • engineered (49)
    Domains in SCOP 1.73: d2b76m1, d2b76m2, d2b76m3
  • Chain 'N':
    Compound: fumarate reductase iron-sulfur protein
    Species: Escherichia coli
    Gene: frdB
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76n1, d2b76n2
  • Chain 'O':
    Compound: Fumarate reductase subunit C
    Species: Escherichia coli
    Gene: frdC
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76o1
  • Chain 'P':
    Compound: Fumarate reductase subunit D
    Species: Escherichia coli
    Gene: frdD
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b76p1
  • Heterogens: FLC, FES, F3S, SF4, FAD, MQ7

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b76A (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaqggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b76A (A:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaqggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppa
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76B (B:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76C (C:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76D (D:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2b76M (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaqggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkittlppakrvyggeadaadkaeaankkeka
    ng
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b76M (M:)
    mqtfqadlaivgaggaglraaiaaaqanpnakialiskvypmrshtvaaqggsaavaqdh
    dsfeyhfhdtvaggdwlceqdvvdyfvhhcptemtqlelwgcpwsrrpdgsvnvrrfggm
    kiertwfaadktgfhmlhtlfqtslqfpqiqrfdehfvldilvddghvrglvamnmmegt
    lvqiranavvmatggagrvyryntnggivtgdgmgmalshgvplrdmefvqyhptglpgs
    gilmtegcrgeggilvnkngyrylqdygmgpetplgepknkymelgprdkvsqafwhewr
    kgntistprgdvvyldlrhlgekklherlpficelakayvgvdpvkepipvrptahytmg
    gietdqncetrikglfavgecssvglhganrlgsnslaelvvfgrlageqateraatagn
    gneaaieaqaagveqrlkdlvnqdggenwakirdemglameegcgiyrtpelmqktidkl
    aelqerfkrvritdtssvfntdllytielghglnvaecmahsamarkesrgahqrldegc
    terddvnflkhtlafrdadgttrleysdvkit
    

  • Chain 'N':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76N (N:)
    aemknlkievvrynpevdtaphsafyevpydattslldalgyikdnlapdlsyrwscrma
    icgscgmmvnnvpklacktflrdytdgmkvealanfpierdlvvdmthfiesleaikpyi
    ignsrtadqgtniqtpaqmakyhqfsgcincglcyaacpqfglnpefigpaaitlahryn
    edsrdhgkkermaqlnsqngvwsctfvgycsevcpkhvdpaaaiqqgkvesskdfliatl
    kpr
    

  • Chain 'O':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76O (O:)
    ttkrkpyvrpmtstwwkklpfyrfymlregtavpavwfsielifglfalkngpeawagfv
    dflqnpviviinlitlaaallhtktwfelapkaaniivkdekmgpepiikslwavtvvat
    ivilfvalyw
    

  • Chain 'P':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b76P (P:)
    minpnpkrsdepvfwglfgaggmwsaiiapvmillvgillplglfpgdalsyervlafaq
    sfigrvflflmivlplwcglhrmhhamhdlkihvpagkwvfyglaailtvvtligvvti