PDB entry 2b75

View 2b75 on RCSB PDB site
Description: T4 Lysozyme mutant L99A at 150 MPa
Class: hydrolase
Keywords: T4 Lysozyme, High Pressure, cavity, HYDROLASE
Deposited on 2005-10-03, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-161)
      • engineered (53)
      • engineered (96)
      • engineered (98)
    Domains in SCOPe 2.08: d2b75a_
  • Heterogens: CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b75A (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk