PDB entry 2b74

View 2b74 on RCSB PDB site
Description: T4 Lysozyme mutant L99A at 100 MPa
Class: hydrolase
Keywords: T4 Lysozyme, High Pressure, cavity, HYDROLASE
Deposited on 2005-10-03, released 2005-11-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-161)
    • engineered (53)
    • engineered (96)
    • engineered (98)
  Domains in SCOPe 2.08: d2b74a_
• Heterogens: CL, BME, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b74A (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk