PDB entry 2b71

View 2b71 on RCSB PDB site
Description: Plasmodium yoelii cyclophilin-like protein
Class: isomerase
Keywords: cyclophilin, Structural Genomics, Structural Genomics Consortium, SGC, ISOMERASE
Deposited on 2005-10-03, released 2005-10-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.21 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclophilin-like protein
    Species: Plasmodium yoelii [TaxId:5861]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b71a1
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b71A (A:)
    gysddeeeesnainvvsektksleekiayykmkghtergyitiytnlgdfevelywyhsp
    ktclnfytlcemgfydntifhrvipnfviqggdptgtgkggksiygeyfedeinkelkht
    gagilsmsnngpntnssqffitlaplphldgkhtifarvsknmtcieniasvqttatnkp
    ifdlkilrtstavnad
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b71A (A:)
    leekiayykmkghtergyitiytnlgdfevelywyhspktclnfytlcemgfydntifhr
    vipnfviqggdptgtgkggksiygeyfedeinkelkhtgagilsmsnngpntnssqffit
    laplphldgkhtifarvsknmtcieniasvqttatnkpifdlkilrtst