PDB entry 2b6h

View 2b6h on RCSB PDB site
Description: Structure of human ADP-ribosylation factor 5
Class: protein transport
Keywords: MEMBRANE TRAFFICKING, GDP, Structural Genomics, Structural Genomics Consortium, SGC, PROTEIN TRANSPORT
Deposited on 2005-10-01, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: N/A
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ADP-ribosylation factor 5
    Species: Homo sapiens [TaxId:9606]
    Gene: ARF5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P84085 (19-191)
      • cloning artifact (16-18)
    Domains in SCOPe 2.07: d2b6ha1, d2b6ha2
  • Heterogens: CL, SO4, GDP, UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b6hA (A:)
    mgsshhhhhhssglvprgslfsrifgkkqmrilmvgldaagkttilyklklgeivttipt
    igfnvetveyknicftvwdvggqdkirplwrhyfqntqglifvvdsndrervqesadelq
    kmlqedelrdavllvfankqdmpnampvseltdklglqhlrsrtwyvqatcatqgtglyd
    gldwlshelskr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b6hA (A:)
    rgslfsrifgkkqmrilmvgldaagkttilyklklgeivttiptigfnvetveyknicft
    vwdvgrplwrhyfqntqglifvvdsndrervqesadelqkmlqedelrdavllvfankqd
    mpnampvseltdklglqhlrsrtwyvqatcatqgtglydgldwlshelskr