PDB entry 2b6f

View 2b6f on RCSB PDB site
Description: Solution structure of human sulfiredoxin (SRX)
Class: oxidoreductase
Keywords: parb domain fold, oxidoreductase
Deposited on 2005-10-01, released 2006-09-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sulfiredoxin
    Species: Homo sapiens [TaxId:9606]
    Gene: SRX, C20orf139
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d2b6fa_
  • Heterogens: MG, ATP

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b6fA (A:)
    gapegpgpsggaqggsihsgriaavhnvplsvlirplpsvldpakvqslvdtiredpdsv
    ppidvlwikgaqggdyfysfggchryaayqqlqretipaklvqstlsdlrvylgastpdl
    q