PDB entry 2b69

View 2b69 on RCSB PDB site
Description: Crystal Structure of Human UDP-glucoronic acid decarboxylase
Class: lyase
Keywords: UDP-glucoronic acid decarboxylase, Structural Genomics, Structural Genomics Consortium, SGC
Deposited on 2005-09-30, released 2005-10-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-10-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.21 Å
R-factor: 0.136
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: UDP-glucuronate decarboxylase 1
    Species: HOMO SAPIENS
    Gene: UXS1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NBZ7
      • modified residue (47-48)
      • modified residue (107)
      • modified residue (124)
      • modified residue (179)
      • modified residue (184)
      • modified residue (204)
      • modified residue (206)
      • modified residue (251)
      • modified residue (309)
    Domains in SCOP 1.73: d2b69a1
  • Heterogens: NAD, UDP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b69A (A:)
    mgsshhhhhhssgrenlyfqghmekdrkrilitggagfvgshltdklmmdghevtvvdnf
    ftgrkrnvehwighenfelinhdvveplyievdqiyhlaspasppnymynpiktlktnti
    gtlnmlglakrvgarlllastsevygdpevhpqsedywghvnpigpracydegkrvaetm
    cyaymkqegvevrvarifntfgprmhmndgrvvsnfilqalqgepltvygsgsqtrafqy
    vsdlvnglvalmnsnvsspvnlgnpeehtilefaqliknlvgsgseiqflseaqddpqkr
    kpdikkaklmlgwepvvpleeglnkaihyfrkeleyqannqgs
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b69A (A:)
    rkrilitggagfvgshltdklmmdghevtvvdnfftgrkrnvehwighenfelinhdvve
    plyievdqiyhlaspasppnymynpiktlktntigtlnmlglakrvgarlllastsevyg
    dpevhpqsedywghvnpigpracydegkrvaetmcyaymkqegvevrvarifntfgprmh
    mndgrvvsnfilqalqgepltvygsgsqtrafqyvsdlvnglvalmnsnvsspvnlgnpe
    ehtilefaqliknlvgsgseiqflseaqddpqkrkpdikkaklmlgwepvvpleeglnka
    ihyfrkeleyqa