PDB entry 2b67

View 2b67 on RCSB PDB site
Description: Crystal structure of the Nitroreductase Family Protein from Streptococcus pneumoniae TIGR4
Class: oxidoreductase
Keywords: alpha-beta sandwich, FMN binding pocket, Structural Genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2005-09-30, released 2005-11-15
The last revision prior to the SCOP 1.73 freeze date was dated 2005-11-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.184
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG0778: Nitroreductase
    Species: Streptococcus pneumoniae TIGR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97S03 (3-203)
      • modified residue (3)
      • modified residue (111)
      • modified residue (139)
    Domains in SCOP 1.73: d2b67a1
  • Chain 'B':
    Compound: COG0778: Nitroreductase
    Species: Streptococcus pneumoniae TIGR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97S03 (Start-203)
      • modified residue (111)
      • modified residue (139)
    Domains in SCOP 1.73: d2b67b1
  • Chain 'C':
    Compound: COG0778: Nitroreductase
    Species: Streptococcus pneumoniae TIGR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97S03 (Start-203)
      • modified residue (111)
      • modified residue (139)
    Domains in SCOP 1.73: d2b67c1
  • Chain 'D':
    Compound: COG0778: Nitroreductase
    Species: Streptococcus pneumoniae TIGR4
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97S03 (3-203)
      • modified residue (3)
      • modified residue (111)
      • modified residue (139)
    Domains in SCOP 1.73: d2b67d1
  • Heterogens: FMN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b67A (A:)
    snamkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknael
    aklaygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefa
    ryseqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpelli
    tvgytdeklepsyrlpvdeiiekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b67A (A:)
    mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl
    aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys
    eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg
    ytdeklepsyrlpvdeiiekr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b67B (B:)
    snamkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknael
    aklaygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefa
    ryseqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpelli
    tvgytdeklepsyrlpvdeiiekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b67B (B:)
    kflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakla
    ygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefaryse
    qqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvgy
    tdeklepsyrlpvdeiiekr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b67C (C:)
    snamkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknael
    aklaygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefa
    ryseqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpelli
    tvgytdeklepsyrlpvdeiiekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b67C (C:)
    kflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakla
    ygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefaryse
    qqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvgy
    tdeklepsyrlpvdeiiekr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b67D (D:)
    snamkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknael
    aklaygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefa
    ryseqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpelli
    tvgytdeklepsyrlpvdeiiekr
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b67D (D:)
    mkflelnkkrhatkhftdklvdpkdvrtaieiatlapsahnsqpwkfvvvreknaelakl
    aygsnfeqvssapvtialftdtdlakrarkiarvggannfseeqlqyfmknlpaefarys
    eqqvsdylalnaglvamnlvlaltdqgigsniilgfdkskvnevleiedrfrpellitvg
    ytdeklepsyrlpvdeiiekr