PDB entry 2b65

View 2b65 on RCSB PDB site
Description: Crystal structure of the complex of C-lobe of bovine lactoferrin with maltose at 1.5A resolution
Class: metal binding protein
Keywords: c-lobe, lactoferrin, maltose, complex
Deposited on 2005-09-30, released 2005-11-15
The last revision prior to the SCOP 1.75 freeze date was dated 2006-09-19, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.194
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lactotransferrin
    Species: BOS TAURUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot P24627 (0-344)
      • see remark 999 (223)
      • see remark 999 (266)
    Domains in SCOP 1.75: d2b65a1
  • Heterogens: MAL, FE, CO3, ZN, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b65A (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcstsplleacaf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b65A (A:)
    ytrvvwcavgpeeqkkcqqwsqqsgqnvtcatasttddcivlvlkgeadalnldggyiyt
    agkcglvpvlaenrksskhssldcvlrptegylavavvkkanegltwnslkdkkschtav
    drtagwnipmglivnqtgscafdeffsqscapgadpksrlcalcagddqgldkcvpnske
    kyygytgafrclaedvgdvafvkndtvwentngestadwaknlkredfrllcldgtrkpv
    teaqschlavapnhavvsrsdraahveqvllhqqalfgkngkncpdkfclfksetknllf
    ndnteclaklggrptyeeylgteyvtaianlkkcsleacaf