PDB entry 2b5x

View 2b5x on RCSB PDB site
Description: Solution Structure of a Thioredoxin-like Protein in the Reduced Form
Class: oxidoreductase
Keywords: Thioredoxin-like, OXIDOREDUCTASE
Deposited on 2005-09-29, released 2006-01-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: YkuV protein
  Species: Bacillus subtilis [TaxId:1423]
  Database cross-references and differences (RAF-indexed):
  • GB CAA10885 (0-147)
    • engineered (143-147)
  Domains in SCOPe 2.08: d2b5xa1

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2b5xA (A:)
  mklrqpmpeltgekawlngevtreqligekptlihfwsischlckeampqvnefrdkyqd
  qlnvvavhmprseddldpgkiketaaehditqpifvdsdhaltdafeneyvpayyvfdkt
  gqlrhfqaggsgmkmlekrvnrvlaete