PDB entry 2b5t

View 2b5t on RCSB PDB site
Description: 2.1 Angstrom structure of a nonproductive complex between antithrombin, synthetic heparin mimetic SR123781 and two S195A thrombin molecules
Class: Blood Clotting
Keywords: Blood coagulation, Blood Clotting
Deposited on 2005-09-29, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.209
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered (204)
  • Chain 'C':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: thrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered (204)
  • Chain 'I':
    Compound: antithrombin-III
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINC1, AT3
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01008
      • engineered (136)
      • engineered (316)
      • engineered (400)
    Domains in SCOPe 2.07: d2b5ti_
  • Heterogens: GOL, SO4, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2b5tI (I:)
    hgspvdictakprdipmnpmciyrspekkatedegseqkipeatnrrvwelskansrfat
    tfyqhladskndndniflsplsistafamtklgacndtlqqlmevfkfdtisektsdqih
    fffaklncrlyrkankasklvsanrlfgdksltfnetyqdiselvygaklqpldfkenae
    qsraainkwvsnktegritdvipseaineltvlvlvntiyfkglwkskfspentrkelfy
    kadgescsasmmyqegkfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekelt
    pevlqewldeleemmlcvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrd
    dlyvsdafhkaflevneegseaaastavviagrslnpnrvcfkanrpflvfirevplnti
    ifmgrvanpcvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5tI (I:)
    dictakprdipmnpmciyrspekipeatnrrvwelskansrfattfyqhladskndndni
    flsplsistafamtklgacndtlqqlmevfkfdtisektsdqihfffaklncrlyrkank
    asklvsanrlfgdksltfnetyqdiselvygaklqpldfkenaeqsraainkwvsnkteg
    ritdvipseaineltvlvlvntiyfkglwkskfspentrkelfykadgescsasmmyqeg
    kfryrrvaegtqvlelpfkgdditmvlilpkpekslakvekeltpevlqewldeleemml
    cvhmprfriedgfslkeqlqdmglvdlfspeksklpgivaegrddlyvsdafhkaflevn
    eegseaaastavviagrslnpnrvcfkanrpflvfirevplntiifmgrvanpcv