PDB entry 2b5m

View 2b5m on RCSB PDB site
Description: Crystal Structure of DDB1
Class: DNA binding protein/protein binding
Keywords: DDB1, beta-propeller, propeller cluster, DNA BINDING PROTEIN/PROTEIN BINDING COMPLEX
Deposited on 2005-09-28, released 2006-02-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.92 Å
R-factor: 0.232
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: damage-specific DNA binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • GB NP_001914 (0-1139)
    Domains in SCOPe 2.07: d2b5ma1, d2b5ma2, d2b5ma3, d2b5ma4

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5mA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssstaphet
    sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
    aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
    tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
    dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlget
    stptqgsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhter
    ktepatgfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5mA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssetsfgee
    vevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypeeaepkq
    grivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvrtecnh
    ynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnf
    lgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqptqgsvlfgt
    vngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgfidgd
    liesfldisrpkmqevvanlreataddlikvveeltrih