PDB entry 2b5g

View 2b5g on RCSB PDB site
Description: Wild Type SSAT- 1.7A structure
Class: transferase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, New York Structural GenomiX Research Consortium, NYSGXRC
Deposited on 2005-09-28, released 2006-01-17
The last revision prior to the SCOP 1.73 freeze date was dated 2006-03-07, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.211
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: HOMO SAPIENS
    Gene: SAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21673
      • modified residue (75)
      • modified residue (96)
      • modified residue (117)
      • modified residue (124)
      • modified residue (166)
      • modified residue (25)
    Domains in SCOP 1.73: d2b5ga1
  • Chain 'B':
    Compound: Diamine acetyltransferase 1
    Domains in SCOP 1.73: d2b5gb1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5gA (A:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5gA (A:)
    akfvirpataadcsdilrlikelakyeqviltekdlledgfgehpfyhclvaevpkehwt
    peghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssm
    hflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmat
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b5gB (B:)
    makfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5gB (B:)
    fvirpataadcsdilrlikelakyeymeeqviltekdlledgffyhclvaevpwtpeghs
    ivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcssmhflva
    ewnepsinfykrrgasdlsseegwrlfkidkeyllkmate