PDB entry 2b5e

View 2b5e on RCSB PDB site
Description: Crystal Structure of Yeast Protein Disulfide Isomerase
Class: isomerase
Keywords: Protein Disulfide Isomerase, ISOMERASE
Deposited on 2005-09-28, released 2006-01-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.191
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein disulfide-isomerase
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: PDI1, MFP1, TRG1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P17967 (4-End)
      • initiating methionine (3)
    Domains in SCOPe 2.04: d2b5ea1, d2b5ea2, d2b5ea3, d2b5ea4
  • Heterogens: BA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5eA (A:)
    aghmqqeavapedsavvklatdsfneyiqshdlvlaeffapwcghcknmapeyvkaaetl
    veknitlaqidctenqdlcmehnipgfpslkifknsdvnnsidyegprtaeaivqfmikq
    sqpavavvadlpaylanetfvtpvivqsgkidadfnatfysmankhfndydfvsaenadd
    dfklsiylpsamdepvvyngkkadiadadvfekwlqvealpyfgeidgsvfaqyvesglp
    lgylfyndeeeleeykplftelakknrglmnfvsidarkfgrhagnlnmkeqfplfaihd
    mtedlkyglpqlseeafdelsdkivleskaieslvkdflkgdaspivksqeifenqdssv
    fqlvgknhdeivndpkkdvlvlyyapwcghckrlaptyqeladtyanatsdvliakldht
    endvrgvviegyptivlypggkksesvvyqgsrsldslfdfikenghfdvdgkalyeeaq
    ekaaeeadadaeladeedaihdel
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5eA (A:)
    mqqeavapedsavvklatdsfneyiqshdlvlaeffapwcghcknmapeyvkaaetlvek
    nitlaqidctenqdlcmehnipgfpslkifknsdvnnsidyegprtaeaivqfmikqsqp
    avavvadlpaylanetfvtpvivqsgkidadfnatfysmankhfndydfvsaenadddfk
    lsiylpsamdepvvyngkkadiadadvfekwlqvealpyfgeidgsvfaqyvesglplgy
    lfyndeeeleeykplftelakknrglmnfvsidarkfgrhagnlnmkeqfplfaihdmte
    dlkyglpqlseeafdelsdkivleskaieslvkdflkgdaspivksqeifenqdssvfql
    vgknhdeivndpkkdvlvlyyapwcghckrlaptyqeladtyanatsdvliakldhtend
    vrgvviegyptivlypggkksesvvyqgsrsldslfdfikenghfdvdgkalyeeaqeka
    aee