PDB entry 2b5d

View 2b5d on RCSB PDB site
Description: Crystal structure of the novel alpha-amylase AmyC from Thermotoga maritima
Class: hydrolase
Keywords: (beta/alpha)7 barrel, HYDROLASE
Deposited on 2005-09-28, released 2006-03-07
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.221
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: alpha-amylase
    Species: THERMOTOGA MARITIMA [TaxId:243274]
    Gene: tm1438
    Database cross-references and differences (RAF-indexed):
    • PDB 2B5D (0-527)
    Domains in SCOPe 2.08: d2b5dx1, d2b5dx2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >2b5dX (X:)
    mrgkiliflhahlpyvhhpeydhfleerwlfeaitetyipllmmfdeiedfrltmsitpp
    lmemlssrdlqekyerhmeklielankevertkkehplkhkmakfyrehfekilnvfrsy
    dgnilegfkkyqetgkleivtcnathaflplyqmypevvnaqitvgvknyekhmkkhprg
    iwlaecgyyqgldlylaqnnveyffvdshafwfadeqprygvyrpimtpsgvfafardpe
    sseqvwsaavgypgdpryrefyrdigfdremeyikdyidpsgvrintgikyhritsksld
    asqkeyydidlameaveehardflhkkesqarrlmdimgvepvivapfdaelfghwwfeg
    vfflkrffelvneskdlklvtasevidtleevqiatpadsswgaggyyetwlngtndwiy
    rhlhemiermidlskkyynssdplvervlnqmlrelflaqssdwafimttrtsvqyaenr
    tklhikrflnlydqlvsgrideemlryyewtdaifpeinfrvmardvi
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5dX (X:)
    mrgkiliflhahlpyvhhpeydhfleerwlfeaitetyipllmmfdeiedfrltmsitpp
    lmemlssrdlqekyerhmeklielankevertkkehplkhkmakfyrehfekilnvfrsy
    dgnilegfkkyqetgkleivtcnathaflplyqmypevvnaqitvgvknyekhmkkhprg
    iwlaecgyyqgldlylaqnnveyffvdshafwfadeqprygvyrpimtpsgvfafardpe
    sseqvwsaavgypgdpryrefyrdigfdremeyikdyidpsgvrintgikyhritsksld
    asqkeyydidlameaveehardflhkkesqarrlmdimgvepvivapfdaelfghwwfeg
    vfflkrffelvneskdlklvtasevidtleevqiatpadsswgatndwiyrhlhemierm
    idlskkyynssdplvervlnqmlrelflaqssdwafimttrtsvqyaenrtklhikrfln
    lydqlvsgrideemlryyewtdaifpeinfrvmardvi