PDB entry 2b59

View 2b59 on RCSB PDB site
Description: The type II cohesin dockerin complex
Class: hydrolase/structural protein
Keywords: protein-protein complex, cellulosome, EF hand, Montreal-Kingston Bacterial Structural Genomics Initiative, BSGI, Structural Genomics
Deposited on 2005-09-27, released 2005-10-11
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.205
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: COG1196: Chromosome segregation ATPases
    Species: Clostridium thermocellum ATCC 27405
    Gene: SdbA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b59a1
  • Chain 'B':
    Compound: cellulosomal scaffolding protein a
    Species: Clostridium thermocellum
    Gene: cipA
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d2b59b1, d2b59b2
  • Heterogens: CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b59A (A:)
    mrgshhhhhhtdlradkassielkfdrnkgevgdiligtvrinniknfagfqvnivydpk
    vlmavdpetgkeftsstfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyket
    gvaeesgiiakigfkilqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvl
    slgdepf
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b59A (A:)
    kassielkfdrnkgevgdiligtvrinniknfagfqvnivydpkvlmavdpetgkeftss
    tfppgrtvlknnaygpiqiadndpekgilnfalaysyiagyketgvaeesgiiakigfki
    lqkkstavkfqdtlsmpgaisgtqlfdwdgevitgyeviqpdvlsl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b59B (B:)
    mnkpviegykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpan
    asgytlkisratyldrvianvvvtgdtsvstsqapimmwvgdivkdnsinlldvaevirc
    fnatkgsanyveeldinrngainmqdimivhkhfgatssdydaqlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b59B (B:)
    gykvsgyilpdfsfdatvaplvkagfkveivgtelyavtdangyfeitgvpanasgytlk
    isratyldrvianvvvtgdtsvstsqapimmwvgdivkdnsinlldvaevircfnatkgs
    anyveeldinrngainmqdimivhkhfgatssdyda