PDB entry 2b58

View 2b58 on RCSB PDB site
Description: SSAT with coa_sp, spermine disordered, K26R mutant
Class: transferase
Keywords: Structural Genomics, PSI, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, NYSGXRC, TRANSFERASE
Deposited on 2005-09-27, released 2006-01-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.204
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Diamine acetyltransferase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: SAT
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21673
      • engineered mutation (25)
    Domains in SCOPe 2.07: d2b58a_
  • Heterogens: COA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b58A (A:)
    makfvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevp
    kehwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrc
    rcssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmatee
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b58A (A:)
    fvirpataadcsdilrlikelaryeymeeqviltekdlledgfgehpfyhclvaevpkeh
    wtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrcs
    smhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate