PDB entry 2b50

View 2b50 on RCSB PDB site
Description: Human Nuclear Receptor-Ligand Complex 2
Class: gene regulation
Keywords: Nuclear Receptor, Protein-Ligand Complex, PPAR
Deposited on 2005-09-27, released 2006-02-14
The last revision prior to the SCOP 1.73 freeze date was dated 2006-02-14, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.199
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peroxisome proliferator activated receptor delta
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (Start-271)
      • conflict (225)
    Domains in SCOP 1.73: d2b50a1
  • Chain 'B':
    Compound: Peroxisome proliferator activated receptor delta
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q03181 (0-End)
      • conflict (225)
    Domains in SCOP 1.73: d2b50b1
  • Heterogens: CA, B7G, VCA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b50A (A:)
    npqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvw
    kqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhe
    aifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdl
    alfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrq
    lvtehaqmmqrikktetetslhpllqeiykdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b50A (A:)
    lkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvwklppyk
    eisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlasivn
    kdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaiilcg
    drpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqmmqr
    ikktetetslhpllqeiykdm
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b50B (B:)
    npqvadlkafskhiynaylknfnmtkkkarsiltgkashtapfvihdietlwqaekglvw
    kqlvnglppykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvhe
    aifamlasivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdl
    alfiaaiilcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrq
    lvtehaqmmqrikktetetslhpllqeiykdm
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b50B (B:)
    npqvadlkafskhiynaylknfnmtkkkarsiltghtapfvihdietlwqaekglvwklp
    pykeisvhvfyrcqcttvetvreltefaksipsfsslflndqvtllkygvheaifamlas
    ivnkdgllvangsgfvtreflrslrkpfsdiiepkfefavkfnalelddsdlalfiaaii
    lcgdrpglmnvprveaiqdtilralefhlqanhpdaqqlfpkllqkmadlrqlvtehaqm
    mqrikktetetslhpllqeiykd