PDB entry 2b4z

View 2b4z on RCSB PDB site
Description: Crystal structure of cytochrome C from bovine heart at 1.5 A resolution.
Class: electron transport
Keywords: ferric form, low ionic strength, electron transport
Deposited on 2005-09-27, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-06, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.196
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cytochrome c
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2b4za_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2b4zA (A:)
    gdvekgkkifvqkcaqchtvekggkhktgpnlhglfgrktgqapgfsytdanknkgitwg
    eetlmeylenpkkyipgtkmifagikkkgeredliaylkkatne